PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10010974
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 196aa    MW: 22264.3 Da    PI: 8.2802
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10010974genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.1e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd++l++ ++ +G+ +W+  ++  g+ R++k+c++rw +yl
      Lus10010974 14 KGTWTYEEDQKLINFIRTYGTCCWRDLPQLAGLSRCGKSCRLRWTNYL 61
                     799*******************************************97 PP

2Myb_DNA-binding46.77.3e-1572110646
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      + E+ + +++++qlG++ W++Ia+ ++ gRt++++k++w++
      Lus10010974  72 EYEENIVINLHAQLGNK-WSKIAAQLP-GRTDNEIKNHWNS 110
                      5699*************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-22563IPR009057Homeodomain-like
PROSITE profilePS5129415.514961IPR017930Myb domain
SuperFamilySSF466895.62E-2811108IPR009057Homeodomain-like
SMARTSM007175.5E-121363IPR001005SANT/Myb domain
PfamPF002491.1E-141461IPR001005SANT/Myb domain
CDDcd001676.94E-91661No hitNo description
PROSITE profilePS5129424.11462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.6E-2364116IPR009057Homeodomain-like
SMARTSM007174.5E-1166114IPR001005SANT/Myb domain
PfamPF002498.1E-1371110IPR001005SANT/Myb domain
CDDcd001674.33E-974109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MGRKPCCEKA GLKKGTWTYE EDQKLINFIR TYGTCCWRDL PQLAGLSRCG KSCRLRWTNY  60
LRPDLKRELL SEYEENIVIN LHAQLGNKWS KIAAQLPGRT DNEIKNHWNS RIKKKLHLLG  120
TEPISCHKPD IQLSTSISSS LTNQPINNAS SESKEAKPSS SMDDDLQSAI TQLAEHLDVP  180
DYRDVTDLSL FKDFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010032717.15e-72PREDICTED: protein ODORANT1-like
SwissprotQ50EX66e-67ODO1_PETHY; Protein ODORANT1
TrEMBLA0A059ADJ05e-72A0A059ADJ0_EUCGR; Uncharacterized protein
STRINGSolyc11g011050.1.19e-70(Solanum lycopersicum)
STRINGSb04g028850.16e-70(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16600.18e-70myb domain protein 43